General Information

  • ID:  hor006559
  • Uniprot ID:  P61366
  • Protein name:  Osteocrin
  • Gene name:  OSTN
  • Organism:  Homo sapiens (Human)
  • Family:  Osteocrin family
  • Source:  Human
  • Expression:  Expression is induced in the developing cerebral cortex in response to neuronal activity in neurons: expression is driven by the presence of a enhancer sequence only present in primates that binds the MEF2 transcription factors . |Expression in the develo
  • Disease:  Diseases associated with OSTN include Acromesomelic Dysplasia 1 and Acromesomelic Dysplasia.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0003416 endochondral bone growth; GO:0007166 cell surface receptor signaling pathway; GO:0009755 hormone-mediated signaling pathway; GO:0030154 cell differentiation; GO:0045668 negative regulation of osteoblast differentiation; GO:0046325 negative regulation of glucose import; GO:1903860 negative regulation of dendrite extension
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSR
  • Length:  50
  • Propeptide:  MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
  • Signal peptide:  MLDWRLASAHFILAVTLTLWSSGKVLS
  • Modification:  T50 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone that acts as a regulator of dendritic growth in the developing cerebral cortex in response to sensory experience (PubMed:27830782). Induced in the brain following membrane depolarization and inhibits dendritic branching in neurons of the developing cortex (PubMed:27830782). Probably acts by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR3
  • Target Unid:  P17342
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P61366-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006559_AF2.pdbhor006559_ESM.pdb

Physical Information

Mass: 649554 Formula: C241H397N85O69S
Absent amino acids: CETWY Common amino acids: RS
pI: 12.31 Basic residues: 14
Polar residues: 15 Hydrophobic residues: 12
Hydrophobicity: -100.4 Boman Index: -17292
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 58.4
Instability Index: 3369.6 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  14523025
  • Title:  Osteocrin, a novel bone-specific secreted protein that modulates the osteoblast phenotype.
  • PubMed ID:  15044443
  • Title:  Musclin, a novel skeletal muscle-derived secretory factor.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  15923362
  • Title:  Characterization of osteocrin expression in human bone.
  • PubMed ID:  27830782
  • Title:  Evolution of Osteocrin as an activity-regulated factor in the primate brain.